PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0094s0370.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 512aa    MW: 56310.5 Da    PI: 7.7342
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0094s0370.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.89.4e-24186229144
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                             d+ep+rC+RtDGKkWRCsr+v +++k+CErH h++r rsrk++e
  SapurV1A.0094s0370.2.p 186 DPEPWRCKRTDGKKWRCSRDVAPDQKYCERHSHKSRPRSRKPVE 229
                             79***************************************987 PP

2QLQ55.81.4e-19121156237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                              FTaaQ+q+L++Q ++y y++a++PvPpeLl++i+k
  SapurV1A.0094s0370.2.p 121 LFTAAQWQELERQTTIYNYMMASVPVPPELLMPITK 156
                             5*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.8E-12120156IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.572121156IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.0E-14122154IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.402186230IPR014977WRC domain
PfamPF088791.6E-19187229IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MRSSWRRTSS GVFVDDAGLG LRMQDNQESC SKRSVMAMSC NLEPAAHELS SSSFRPKFYG  60
TGNHVTCFGD INDVVSASGT GSTDAITVSK SLQYPYFTSD SSLFTFNSSG EMTPSVNERV  120
LFTAAQWQEL ERQTTIYNYM MASVPVPPEL LMPITKNQSN VLPPKSNSNI INSSLELGIP  180
SLNSSDPEPW RCKRTDGKKW RCSRDVAPDQ KYCERHSHKS RPRSRKPVEL HSHDSLRTLT  240
NNNTNTNNNN CSTNPHLFNQ KPYFPNHLFM FSSAMASSAN SYDQPRSLEW LLKGENLPVA  300
SNHSPEWQHL KRDGIKGNGK LYNLYREEQP LCSNTYRGGH SLQAQRLNDH CSMFSSPKSN  360
SLERALNPSM TEAQETRHFI DAWSTDSGRD DIGGIGQKSY VSSSEKLVLP HSALALSPGT  420
RTETNDEGNG GPQLSSFGIM GSWDSHHQST VSGLRPQWMT SHGGSWMVSP PGGPLAEALC  480
LGISSNAKTA SNLPSPCSSS CGPNVDQNQL I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002297943.10.0hypothetical protein POPTR_0001s11480g
TrEMBLB9GK640.0B9GK64_POPTR; Uncharacterized protein
STRINGPOPTR_0001s11480.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.19e-41growth-regulating factor 8